CK1 alpha 1 (C-Term) anticorps

N° du produit ABIN632245

Cet anticorps Lapin Polyclonal détecte spécifiquement dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CK1 alpha 1 (C-Term) anticorps (ABIN632245)

Antigène: CK1 alpha 1

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit

Épitope: C-Term

Specificité: CK1 alpha 1 antibody was raised against the C terminal of CSNK1 A1

Purification: Affinity purified

Immunogène: CK1 alpha 1 antibody was raised using the C terminal of CSNK1 A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK1 alpha 1 Blocking Peptide, (ABIN939219), is also available for use as a blocking control in assays to test for specificity of this CK1 alpha 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: CK1 alpha 1

Sujet: CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.

Poids moléculaire: 37 kDa (MW of target protein)